DPCstruct | MC12959
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 65 ± 4 aa |
| Standard deviation of domain lengths | 3.87 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 54.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0561 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183R2Z3 | 1-63 | MSFTSDEVNFLIFRYLQESGYCHSAYLFGLESQISQSNVDGALVPPGSLLSLIQKGLQYTEAE |
| A0A7R9QGI3 | 1-55 | MSFSSDEVNFLVYRYLQESGFSHSAFTFGVESHIAQSNINGGLVPPAALLSIIQK |
| A0A2P2MRI8 | 1-66 | None |
| A0A6N2AY48 | 1-74 | None |
| A0A0N4W3V6 | 1-67 | None |
| A0A830D5T4 | 1-67 | None |
| A0A6N2M7G6 | 1-68 | None |
| A0A1Y3NWW4 | 1-68 | None |
| A0A4U5MT38 | 1-63 | None |
| A0A7J0GH97 | 1-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.