DPCstruct | MC12958
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 167 ± 19 aa |
| Standard deviation of domain lengths | 19.35 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 43.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I8HYJ9 | 73-237 | AQKTELSQALQSLSEQAKSGSEFLQRLKSSSERIKSNREVMAAAVTEQFDSLVSALQSKKQVMLSQLASEQEHKLRLTRDQAAQCAS… |
| A0A7R9QC80 | 7-161 | KNCIFPKGIKFCSHSIAIFASRLAIENSLNFETEISSQCDNLIATIKTRKQQLLTFARKEKDYKLRILREQVMACTAKLQQTTGLIQ… |
| A0A183KU00 | 2-163 | None |
| A0A1I8H1R2 | 11-187 | None |
| A0A0B1TFC0 | 9-183 | None |
| W5JFB2 | 2-140 | None |
| F4WFS2 | 106-284 | None |
| A0A182R005 | 5-173 | None |
| A0A368GQP7 | 2-166 | None |
| A0A1A9XQ70 | 73-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.