DPCstruct | MC12957
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 114 ± 11 aa |
| Standard deviation of domain lengths | 11.39 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0179 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G7PUT5 | 1-109 | MSAKAISEQTGKELLYKFICTTSAIQNRFKYARVTPDTDWARLLQDHPWLLSQNLVVKPDQLIKRRGKLGLVGVNLTLDGVKSWLKP… |
| A0A7R9QBX9 | 1-90 | MSAKAIREATGKDLLNRFLKGSANTSRYAVVHEDTNFSDLVAQQPWLKTERLVVKPDQLIKRRGKLGLILVNADIDSVKKWVADRMA… |
| A0A287QLS7 | 1-108 | None |
| A0A813UVU4 | 1-106 | None |
| M7YPN4 | 1-109 | None |
| M5FQP0 | 1-123 | None |
| A0A5E4IL21 | 138-247 | None |
| A0A816IV61 | 631-753 | None |
| A0A2N1L0M9 | 1-126 | None |
| A0A2I0RRA6 | 1-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.