DPCstruct | MC12956
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 103 ± 15 aa |
| Standard deviation of domain lengths | 14.81 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 46.75 |
| Pfam Score | 97.73 |
| Assigned Pfam label(s) | CL0020- CL0366 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F7EUU4 | 59-158 | SGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETM… |
| A0A7R9QBW4 | 17-100 | ENVESIDEIYKYNRKQQQDILTAKPWEKDPHYFKDIRVSALALLKMVMHARSGGTLEVMGLLLGKVDANTMIAMDSFALPVEGT |
| A0A4Y7NEP0 | 6-115 | None |
| A0A2T3A5I3 | 189-287 | None |
| A0A1U8M4P4 | 11-105 | None |
| A0A654GVJ9 | 28-135 | None |
| A0A504WZ23 | 40-125 | None |
| A0A066VC81 | 15-113 | None |
| A0A813M4B9 | 852-984 | None |
| A0A7D9GYN8 | 25-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.