DPCstruct | MC12955
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 108 ± 6 aa |
| Standard deviation of domain lengths | 5.50 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 74.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 62.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12308 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W5Q066 | 12-114 | NSSLALQVPKDGWKVYSSAQDAEGRCICTVVAPEQNLCSRDAKEGQLRQLLEKVQNMSQSIEVLNLRTQRDFQYIMRMEGQFKGLRS… |
| A0A0Q3X9F8 | 1-118 | MRRELRLRRLTLPSRVPQTLFQSPDEGWQVYTSAQAPDGKCLCTAVIPVQGSCARDLRSHQLRQLMEKVQNISQSMEVLDLRTYRDL… |
| A0A2I0T3V0 | 4-107 | None |
| Q6DGM5 | 21-124 | None |
| A0A4W5L030 | 1-117 | None |
| A0A4W5KXC0 | 66-167 | None |
| A0A7J8IPW4 | 41-152 | None |
| A0A493SUL4 | 18-128 | None |
| A0A4Z2FKL2 | 25-130 | None |
| A0A0S7G7Y8 | 19-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.