DPCstruct | MC12953
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 111 ± 9 aa |
| Standard deviation of domain lengths | 9.09 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 67.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 46.32 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0266- PF01412 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B6DE62 | 520-632 | NGSVDCKAETPNVKKRHRRIKSSSVRNQDCDDSDGYEFLIVSLDNKQWHFEASNSEERDEWVTAIEQQILNSLQGNESSKGKSRLHS… |
| A0A6G0XJU1 | 1-90 | MFTLVDTDGYEFLIVSLDNKQWQFEANSSEDRDEWVAAIEQQILNSLQSNEINKVNVGGKFGSSYNRAEDVQNIRTRVPGNGQCADC… |
| A0A3M6TWF9 | 298-419 | None |
| A0A132ADF8 | 17-122 | None |
| G3HB65 | 458-574 | None |
| K7GI42 | 240-350 | None |
| A0A7I8W2C5 | 741-854 | None |
| A0A1B0CM56 | 57-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.