DPCstruct | MC12952
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 108 ± 9 aa |
| Standard deviation of domain lengths | 9.10 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 93.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 33.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S4UA40 | 17-129 | SSAVENPPVLQDNIVLKEALHRVLRLPVVAEKTFLITIGDRSVTGMVARDQMVGPWQIPVSDVAITTASLDSYHGEAMAMGERAPVA… |
| A0A446JA11 | 67-175 | APEITLMDVLKRVLKLPSVCSKRFLTTKVDRCVTGLVAQQQTVGPLQLPLADVAVVAQTYTDLTGGACAIGEQPIKGLLNPEAMARL… |
| A0A7E4RDR1 | 457-561 | None |
| A0A329P9D6 | 190-303 | None |
| A0A7X9KTU5 | 619-723 | None |
| A0A1V3WVS2 | 147-265 | None |
| V9GLD2 | 146-263 | None |
| A0A0V0RYY1 | 12-99 | None |
| A0A3B8ZXB9 | 565-674 | None |
| A0A812M9D7 | 81-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.