DPCstruct | MC1295
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 93 ± 10 aa |
| Standard deviation of domain lengths | 10.22 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 31.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0260 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H0UH69 | 95-174 | RPMLLTMLEWKVGIQTNFSISVGKNSKYLEKYLSEQCWESLLSTYADGSYEGTWKALFTMGELFRSTAKYVADHLHYTYP |
| A9J069 | 2-99 | ISWKVGIETGFKLSVGKNYKFIERYISEDLWEKLLSTYRMDSYENIWEALFLCHQLFRAVSGEVAERLHYAYPEYDRNITKYTRDMY… |
| A0A7T6ZE99 | 2-71 | None |
| A0A2T6G0J3 | 2-95 | None |
| A0A824BJT2 | 40-156 | None |
| A0A174QPD6 | 339-433 | None |
| A0A3D4BAM8 | 49-133 | None |
| A0A2S0T1L4 | 1-89 | None |
| A0A7X9F165 | 2-87 | None |
| A0A1R3L3T0 | 688-791 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.