DPCstruct | MC12948
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 151 ± 13 aa |
| Standard deviation of domain lengths | 13.44 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 37.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151R6M0 | 2-136 | KELLKEAKSVIGIPTFQIIVAQGVFGSFPWSGLSFATLWLELIGFSHVTTATLWTLFIVAASFGSLFGGWMGDFLSQRLPNSGRIIL… |
| A0A812WCU5 | 171-333 | MREFHKLAKFLRLGSFRVIILQGVFGTIPGAAQTFTTMYFQYLSISNHMCGLIIAMRTVGEGIGGALGGYLGDAANAKNHRYGRTWV… |
| A0A0A9D9G7 | 2-135 | None |
| A0A287IJR5 | 2-157 | None |
| A0A287RD15 | 5-142 | None |
| I0YKA0 | 222-387 | None |
| A0A813D4K6 | 276-448 | None |
| A0A287RD18 | 58-193 | None |
| A0A453IKS3 | 123-257 | None |
| A0A813G2S6 | 779-934 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.