DPCstruct | MC12945
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 158 ± 14 aa |
| Standard deviation of domain lengths | 14.07 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 66.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.55 |
| Mean length-normalized TM-Score | 0.28 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 46.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y1QSL9 | 1-166 | MGRKKKFIDKKKSATFQLLARDSSDPNYDYSPGSDRVFIRVDNSSYAVDALFPEDNPHDASGAGGYDDDPNSIFADAPEDDGGGQDY… |
| A0A151QLE8 | 1-148 | MGGRKKKFIDKKNSATFQLIARDSSDPSFSHSDRVFVRVDNNPVSIPVAADSIYEDAPDDGDDDDDEYGAGLDGGPLPEDVRREILE… |
| A0A1D6PR52 | 1-141 | None |
| A0A059CA46 | 1-175 | None |
| A0A446M0T8 | 1-148 | None |
| C0HGK5 | 1-150 | None |
| A0A2G9HWS6 | 1-143 | None |
| A0A0E0EEW7 | 38-218 | None |
| A0A498HUU1 | 1-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.