DPCstruct | MC12944
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 209 ± 22 aa |
| Standard deviation of domain lengths | 21.92 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 67.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.83 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 55.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R4L1Y8 | 82-289 | GLKSGAFNAGLSYNSKTRSVSGNAGLTTEGGTGFALSYNEGDGFGASISKSLDSGLNGGLSWSQKGGVGGNIGYEAPGDKNQPKNSL… |
| M5VEE7 | 4-205 | KKGGFNAGLSYNSKTGSVSGNAGFTSQSGTGFALSYNEGDGFGASISKSLDSGLNGGLSWSEKGGVGGNIGYEAPGDKNQPKNSLAN… |
| A0A1T1DPQ1 | 1-189 | None |
| A0A6H3NZS7 | 22-213 | None |
| A0A0E2BQL7 | 126-312 | None |
| A0A0E2BDW4 | 1-234 | None |
| M6QQJ6 | 145-391 | None |
| M6QGZ7 | 82-306 | None |
| M6V1R3 | 535-721 | None |
| A0A540SZT9 | 20-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.