DPCstruct | MC12942
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 128 ± 14 aa |
| Standard deviation of domain lengths | 14.46 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 72.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 39.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R1EV74 | 1-137 | MSASNPENSLYNSIHARALRLVEKPTMVMPFTTPSGHMHMLRHLAPDLVYLTEDLSGIQGEYVEQTRNWVGQIMIVVGASGVGLGLV… |
| A0A0H1BKI8 | 1-110 | MILPFSTPNGHVHMLRHLSPDIVYIQESMTGNDGEPVNQISGWVRQVVVVVGAEGGRGGLVDSDDESALGTDKGEKWWQKEGVTGLG… |
| A0A428SKH4 | 47-153 | None |
| A0A0M8N066 | 170-308 | None |
| A0A4U0TV51 | 385-512 | None |
| A0A1Z5TI98 | 102-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.