DPCstruct | MC12941
Metacluster Properties and Pfam Annotations
| Number of structural domains | 70 |
|---|---|
| Mean domain length (aa) | 133 ± 25 aa |
| Standard deviation of domain lengths | 24.98 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H1BH22 | 1-113 | MEAACGMQLAQVWENMDLNDRKSIIEDRIGIEKRLVSVSFSLYGSLYFIQDSFAGCKSAEITTNIAASGRDDVKRKFVAGPIALREF… |
| A0A3M7K7C3 | 474-623 | LDVEMKMKVLRKIASYQENWVRTCFSQYGSLYYKRDLGYSAPSIKYTDNRGMAIVDERFAVGPSVSRQNNDDGRVDIDFDRGPWNTA… |
| A0A0C3BQ93 | 1-155 | None |
| W6Z8U0 | 1-153 | None |
| M1VZZ3 | 137-294 | None |
| C4JVN1 | 546-722 | None |
| C4JP71 | 206-315 | None |
| A0A1V6PME8 | 197-331 | None |
| A0A229XXG8 | 504-657 | None |
| A0A229Y2G8 | 286-401 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.