DPCstruct | MC12940
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 142 ± 13 aa |
| Standard deviation of domain lengths | 12.62 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 71.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 34.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0184 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H1BG28 | 1-168 | MYEVLGQLGLYGMFIIGVQAAIFDRESFASATWNGQVGGYLTGYTFCLFIFYSLAPILFRLASAAFFNISLLTANFWGVIIGVNVFK… |
| A0A1D1Y4F2 | 1-122 | MLGVFGMLVSICEIVLLERKTLESVKWSPTVISLFAGFAVAAFLFYTVVPFILKMSGATLFNLSLLTSDMWAVVIRIFFYRQQVDWL… |
| A0A8B6ERD0 | 126-254 | None |
| E4XVX6 | 95-244 | None |
| A0A5A9MXE6 | 88-231 | None |
| A0A337SDZ5 | 167-298 | None |
| A0A446J4F5 | 1-152 | None |
| A0A0C9YA61 | 49-182 | None |
| A0A401PBU5 | 66-204 | None |
| A0A4S4LFB9 | 170-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.