DPCstruct | MC1294
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 215 ± 36 aa |
| Standard deviation of domain lengths | 35.72 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 16.35 |
| Pfam Score | 90.28 |
| Assigned Pfam label(s) | CL0031- CL0166 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5S9M8L8 | 2-180 | IFDFQRYACISFQEPKALEQNLTMHLIPAYYRLIYHISMINELTDSIKKAQPEVFEITQKVACHLEKAACSKLSDHEIAYLAMHFGS… |
| A0A7X3BYN1 | 16-214 | FSSGKLPFSQRVLDVTHYYFSRMCMDNREIETTDPDFVDLASHISPLLRRLDNRVQIKNSLLSQILLTYPNLVKELTTISKEVSLVF… |
| A0A2L1TY20 | 295-509 | None |
| A0A242CDI5 | 16-266 | None |
| A0A7U8INL8 | 7-240 | None |
| F9P7K1 | 27-266 | None |
| A0A381H917 | 93-271 | None |
| A0A7W1XB39 | 346-656 | None |
| A0A1S1BP42 | 57-315 | None |
| B0NY60 | 164-381 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.