DPCstruct | MC12936
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 72 ± 8 aa |
| Standard deviation of domain lengths | 7.57 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 34.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X5UB15 | 18-91 | NEVRLATWPKESGIRLPIRAFFYVPAASGALAKAQGDQRRYRDQYGLSVPILQLVLPVGVGMPTRFDYNPADQV |
| A0A423DS03 | 212-279 | TWDEQRFRELPIQSFFYLEGSPGGLEDAQRVQRDWYQEAGTFVPVIQISLPWAEQPARFVFNPEDQVI |
| A0A3D3M714 | 1-71 | None |
| A0A2G0WHK4 | 41-120 | None |
| A0A1E3LFJ1 | 10-79 | None |
| A0A2N3PG08 | 205-274 | None |
| A0A1Y3KN92 | 366-438 | None |
| A0A348HI41 | 351-419 | None |
| A0A7U4STZ2 | 163-230 | None |
| A0A1S2CST5 | 52-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.