DPCstruct | MC12935
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 149 ± 16 aa |
| Standard deviation of domain lengths | 15.98 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 40.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D6AGI2 | 26-156 | LIASGDTRQFLWQLMTEKNTPLINEILLRIKQHPDFPDWRIKKKLPKYFLARQIAELKNNYPFEGQPSRFYASVNKIISYIYKSWFE… |
| A0A1E5QY38 | 1-147 | MTQITIQCRLIASADTRQFLWMLMSQKNTPLINEILTRIRENPDFSQWEEKGKLPKNFISQQIAELKNDSCFQGQPSRFYASVGKII… |
| A0A6G3Z6W1 | 14-157 | None |
| A0A1Z4HHQ0 | 12-166 | None |
| A0YWR6 | 5-164 | None |
| A0A2T1D8B6 | 1-191 | None |
| A0A0D6ACB2 | 12-148 | None |
| A0A7Y3TUB6 | 18-168 | None |
| A0A846A9U0 | 1-153 | None |
| B7JWD4 | 12-168 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.