DPCstruct | MC12932
Metacluster Properties and Pfam Annotations
| Number of structural domains | 372 |
|---|---|
| Mean domain length (aa) | 84 ± 12 aa |
| Standard deviation of domain lengths | 12.33 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 25.08 |
| Pfam Score | 99.50 |
| Assigned Pfam label(s) | CL0680- CL0521- CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C3Z8B7 | 4-80 | LGPLPPGWEMAHTASGQRYYLNHNNQTTTWEDPRNVGTGLNNINNIPLPEGWEQATTPEGEIYFINHRTQTTTWLDP |
| A0A813JBF8 | 347-419 | RKEQDQFQDEPGLPEGWIRVKSKTGQTYFWNTRKKESTFEFPLPAGWTRQVSKSSGKPYYFNVKKRKSSFDVP |
| A0A1S3PVQ8 | 807-903 | None |
| A0A7S3ZZH0 | 95-164 | None |
| A0A7S1XRG1 | 76-139 | None |
| K8EJ31 | 54-149 | None |
| A0A7S2RIP7 | 29-111 | None |
| A0A6G1IGR8 | 47-144 | None |
| A0A7R9L0N5 | 171-259 | None |
| A0A816RR43 | 268-351 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.