DPCstruct | MC12930
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 126 ± 19 aa |
| Standard deviation of domain lengths | 18.70 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 78.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.83 |
| Pfam Score | 88.89 |
| Assigned Pfam label(s) | PF00779- CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A673BRW5 | 51-144 | GCIELSRIRCVEIVRTDVTIPCANKYPFQVFHDNLYLYIFAPDNDCRQRWVRALKEETMHNDLVPKYHPNFWMDGKWRCCHQTEKLA… |
| C3Z472 | 1-93 | MTHRICAVERVDENAFQRTNVFQVIIRDGDGSLSTTYLQAKDVNEMHQWLSAIRKTCVTNSRMLGTFHPGTHRASKWTCCLETDKTA… |
| A0A2K6GTE4 | 48-169 | None |
| A0A1B0AEN0 | 4-164 | None |
| A0A6L5CUQ8 | 7-139 | None |
| A0A182U687 | 13-147 | None |
| A0A0N1PHL0 | 80-200 | None |
| A0A1X7STQ7 | 92-215 | None |
| A0A1A7ZM60 | 54-168 | None |
| S9XGX9 | 7-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.