DPCstruct | MC12929
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 142 ± 23 aa |
| Standard deviation of domain lengths | 22.98 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 69.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 39.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05719 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A849DNZ2 | 1-115 | MTGFHGEAAAGGKHRPASTSSASDLEPGPLTLSGDLFLIMLDDATGWLRVRPRIAGYALAGAFLIELRGPGYISFDADRIRVHGNRA… |
| C3Z318 | 1-123 | MTSLQQRSSGLVQRRTDASRGAEGGKEIEREVIEAEFEEESDSSKDTRLTLMEEVLLLGLKDREGYTSFWNDCISSGLRGCMIMELG… |
| A0A0S7GR41 | 1-119 | None |
| A0A7E4S4J9 | 10-122 | None |
| A0A4S8KV13 | 294-440 | None |
| A0A1J0VMA7 | 1-123 | None |
| A0A2R4FUN7 | 13-173 | None |
| A0A661A300 | 35-144 | None |
| A0A7R8X7N7 | 565-711 | None |
| A0A0G4N4C2 | 353-522 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.