DPCstruct | MC12928
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 210 ± 27 aa |
| Standard deviation of domain lengths | 26.59 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 75.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 27.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04821 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7ID18 | 2-145 | MERIIVLLRYIFAIPPTDRDGIRTATDSSSHDRLISAFLESGIEQVLIHIASQSKERDFHLSILVIFAMIIKEHNVEDVVVAGRDRT… |
| C3Z057 | 8-196 | VWTVLSRKLYELLQLDWENRQEEDSMLIERILLLVRNILHVPADPEEEKRTDDDASVHDQVLWAIHQSGFDDLLKFIASSDSEQQWC… |
| A0A6A4VET4 | 137-352 | None |
| A0A671N5S9 | 1-174 | None |
| A0A0K9R515 | 124-353 | None |
| A0A1D6MD85 | 126-356 | None |
| A0A183RWS9 | 19-210 | None |
| A0A7R9JJE5 | 1-167 | None |
| A0A5K3FJF5 | 17-255 | None |
| A0A2I0K4K7 | 12-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.