DPCstruct | MC12927
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 258 ± 47 aa |
| Standard deviation of domain lengths | 47.18 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 20.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C3YZP7 | 426-702 | MSDHFHQLQINFNSWAKDPQSLMAGEPLFPTVQAKQDAVFKSLFHEQDEELRTLTCQALKYIMEEFMEVTDRMLKDYLPGGLFHQPS… |
| A0A6J8A5V4 | 2-157 | EGITMWTQNHTANWLESLDEAHREQDLRQAREDSREQCQRYVERLADIRQQRQKALAMKREKKEAKEQRDRTKKEKLTQKLQEVGGL… |
| A0A401H4J4 | 49-359 | None |
| A0A4Y9XVL9 | 3-247 | None |
| A0A1I8I9B5 | 247-513 | None |
| A0A1D3RPN1 | 2-253 | None |
| A0A0C9V2I8 | 33-309 | None |
| A0A0D0D1N7 | 127-390 | None |
| A0A8B6EUL1 | 415-687 | None |
| C3ZKV2 | 658-975 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.