DPCstruct | MC12925
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 158 ± 11 aa |
| Standard deviation of domain lengths | 10.68 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 78.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 88.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10148 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A803Y955 | 84-239 | MSKQSSSYSDRDTTEEESESLDDMDFLTRQKKLQAEAKMALAMAKPMAKMQVEVEKQNRKKSPVADLLPHMPHISECLMKRNLKPAD… |
| C3YV32 | 1-132 | MAALRSGAQEGDDTDFLTKEAELKKEAQLALAMAKPMAQMQMEVEKQNRKKSPVADVVAATPSMAVISENLKRRKLKQRDLMNMSPG… |
| A0A6J3DEB7 | 180-335 | None |
| A0A6P3RQK5 | 101-269 | None |
| A0A670I2D3 | 320-500 | None |
| A0A212CIP4 | 1-154 | None |
| A0A3Q2QUL2 | 447-615 | None |
| A0A6B0QTJ8 | 335-488 | None |
| A0A6J2L0V1 | 302-457 | None |
| A0A1A8QDT7 | 564-718 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.