DPCstruct | MC12924
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 154 ± 18 aa |
| Standard deviation of domain lengths | 17.60 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 66.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 26.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C3YRP2 | 8-160 | VLRGDATLVGQNLLVVVKAVRGEAPLLEEALLARFEADVPPRSLSDDELAERLETLTGENSGFLLDMTGKDLRAHETIVRLAHFLIM… |
| A0A0K2UNH8 | 7-165 | LMLNPKSSLLDADLTRVYSHFNASSVPVDQEACFKKNEKVGSMAKSMLKHRIQSLTGKNIGTIEKELGIPSPPDGPGLDVSSLRKLA… |
| A0A6P4YA88 | 20-186 | None |
| A0A8B6CHB0 | 2-124 | None |
| A0A8B6C7C8 | 2-134 | None |
| A0A8B6ENE9 | 7-144 | None |
| A0A6P4ZQV2 | 5-166 | None |
| A0A6P4Z7K0 | 5-169 | None |
| C3Y306 | 9-165 | None |
| A0A6J8ARK0 | 2-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.