DPCstruct | MC12920
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 55 ± 5 aa |
| Standard deviation of domain lengths | 4.66 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 66.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 58.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D2NBD0 | 37-92 | PNNTQLNPKKRLSPKSSPVRRPRGDTKKCRKVYGMDRRDLWCTQCKWKKACTRFGD |
| C3YKU5 | 1-49 | MSPKTAGSVPFPRKIRSEGKKCRKVYGMENRDLWCTQCRWKKACSRFLD |
| A0A4Y2P729 | 63-116 | None |
| A0A060XZ51 | 31-87 | None |
| A0A834DW15 | 169-228 | None |
| H9JDA2 | 123-178 | None |
| A0A0L7LU69 | 84-129 | None |
| A0A6S7JS06 | 96-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.