DPCstruct | MC1292
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 70 ± 5 aa |
| Standard deviation of domain lengths | 4.92 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 31.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5A9EUE6 | 7-71 | AHGMLCPKCGQDDCIDVAALVHVRLTGSGSDADLSFDGSHEWDDDSRCCCGACGHGGTVSDFRKA |
| A0A0D5MBD6 | 1-70 | MTTPTNNLAGMQCPKCGHNAGFKIEATCLATVFDDGIDDSIEYDWNEHSACHCHSCKYHGVVGDFQGAEV |
| A0A2N2AMF9 | 5-73 | None |
| A0A4R7KM24 | 9-78 | None |
| A0A1R1QY04 | 1-66 | None |
| A0A318KZ60 | 1-59 | None |
| X0RIX7 | 14-83 | None |
| A0A5N7MWC9 | 2-70 | None |
| A0A1W9GG50 | 18-90 | None |
| A0A497BAS7 | 3-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.