DPCstruct | MC12916
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 158 ± 25 aa |
| Standard deviation of domain lengths | 25.14 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 14.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E4BFN6 | 2-124 | EQIEKSTYQGYLWYSDKDQPKVLNNVDSEITLDETKNPFVIEGQLFDGKRSISIKYVDGKYIVKKYVLAELPKEDFTEQSLLAHRMK… |
| A0A7X9PUC9 | 4-154 | INETINAPDLIQDKHYFVAWLQNAVRIGIWTPEGGFQAADGQPVDGSLLFSVRIFNASEELHFFKYQGKFLSRLKKDPENEPTYIQE… |
| A0A328C6N8 | 1-138 | None |
| A0A5C4JQX0 | 9-183 | None |
| A0A4Q8C0D0 | 49-226 | None |
| A0A3M1EN24 | 1-191 | None |
| A0A850SV14 | 1-147 | None |
| A0A1I0AUI5 | 2-123 | None |
| E6LNT5 | 3-177 | None |
| A0A1E5G2H5 | 6-161 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.