DPCstruct | MC12915
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 133 ± 13 aa |
| Standard deviation of domain lengths | 12.68 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5CML9 | 239-350 | NADYKAYINIGGGLGSIGSHYNLSILGNGLIRRLPAHNFSVKGTMILFGERGIPIINIADIKELAQRYKFPVAPEPLPPIPSGSLFF… |
| A0A7X9K4J3 | 1-143 | TRETVYDQMLPEGQRYKLFVNIGRGLANVGSEPNANQITEGLTRKLAEKEFFPEGIMMVMARKNVPIFSIQHIQRWVKKYKLQTNST… |
| A0A7X7LKI2 | 1-118 | None |
| X1BZA9 | 63-190 | None |
| A0A7X8LDW8 | 135-253 | None |
| A0A3M1CYP5 | 67-209 | None |
| A0A1Y1RG94 | 86-223 | None |
| A0A2E8S0P3 | 416-557 | None |
| A0A1W9RZB5 | 266-398 | None |
| M3IAW5 | 320-475 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.