DPCstruct | MC12914
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 146 ± 15 aa |
| Standard deviation of domain lengths | 15.03 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03000 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7N0UIA4 | 160-282 | YTRPGYQRRHPAAPMDWWTEDLSYLDLELFRSVIVSVGFTNTLSPQLIGEALHVYASCNLFPSNRSFEDKKRMLESITSLIPLDRGS… |
| A0A0S3TC21 | 5-152 | DRTSEDAAPNQESWWFNDVATFRIDHFIRIISAIRAKGTRAEIIGKCIIEYAKKWLSGMDVEIEGLRGYGHEKYNLQFSIFSGKKKE… |
| A0A804HU69 | 173-328 | None |
| A0A453KJ23 | 69-219 | None |
| A0A2Z6LNY7 | 66-201 | None |
| A0A835PQ77 | 55-203 | None |
| A0A200Q5V0 | 666-822 | None |
| A0A287QBJ3 | 300-468 | None |
| A0A1U8KV60 | 186-349 | None |
| A0A6M2EUE5 | 211-329 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.