DPCstruct | MC12913
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 78 ± 13 aa |
| Standard deviation of domain lengths | 13.34 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 49.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0046 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A438GLX1 | 4-81 | VEEIRNAQRAKGPATILAIGTATPDHCVYQSDYADYYFRVTKSEHMTELKKKFNRICDKSMIKKRYIHLTEEMLEEHP |
| A0A0S3T723 | 67-144 | MVTVSEIRQAQRAEGPATILAIGTATPPNCVDQSTYPDYYFRITNSEHMTDLKEKFQRMCDKSMIKKRYMHVTEEVLK |
| A0A445D7A5 | 1-73 | None |
| A0A0D3GPG7 | 11-91 | None |
| A0A5P1F1Y1 | 1-88 | None |
| A0A5P1FEE8 | 237-313 | None |
| A0A0D9XSM8 | 2-84 | None |
| A0A444WPC9 | 4-82 | None |
| A0A0K9QLZ5 | 4-86 | None |
| A0A444C6T0 | 55-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.