DPCstruct | MC12912
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 70 ± 3 aa |
| Standard deviation of domain lengths | 2.76 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 80.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 62.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4HRK2 | 59-134 | IADLPIELIELLEKIIIELSPFNDNKNLQNLLPLTAVCADKGKVVGYINKLQNYDYMEIAKIATEHGLFEEALTIY |
| A0A0S3SWD0 | 1-75 | MTADLPHELIELLEKIVLHNSAFSGNFNLQNILILTAIKADPFRVMDYINRLDNFDGHAVGEMAIEAQLYGTNTC |
| A0A7J0E7A0 | 199-268 | None |
| A0A819NSB9 | 795-862 | None |
| Q10161 | 995-1061 | None |
| A0A4Y9ZVK1 | 51-123 | None |
| A0A7J6VZ10 | 310-379 | None |
| A0A7J7MRW0 | 254-320 | None |
| A0A7J7LRR7 | 224-293 | None |
| A0A7J6W2W8 | 46-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.