DPCstruct | MC12910
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 77 ± 8 aa |
| Standard deviation of domain lengths | 7.72 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 72.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 52.72 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | CL0048- CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9J3V5 | 81-138 | RGAESGWFVLWQMNPDMWYVELAVNGCKVHAGCNGNLVWRHTPWLGAHTAKGPVRPLR |
| A0A0S3SS68 | 1-67 | MGKVKVKKMQKKGEVGGFVVWQKKPELWCLELVVSGYKISAGSDGKVAWRQTPWHHSHASRGPPRPL |
| A0A843VVK0 | 122-205 | None |
| A0A5C7ITC0 | 81-162 | None |
| A0A811PKV4 | 9-88 | None |
| R0HGK1 | 114-185 | None |
| A0A540K3V5 | 3-82 | None |
| A0A699I928 | 1-70 | None |
| A0A444FXQ7 | 12-82 | None |
| A0A453B6E3 | 10-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.