DPCstruct | MC1291
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 98 ± 4 aa |
| Standard deviation of domain lengths | 3.54 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 84.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 35.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q7NH75 | 1-96 | MNVEISPALVINAPEFFADPDFQSWLNNSDRKFTWHRNGAPDEWSDTVVMVDPGLTGAGSDSDMPEAIWDQIVSTCRLHIAPRRGVP… |
| A0A0D5MBC6 | 51-146 | ESSLEPAVLVRVDWFDHPTFQNWANKARVSGLASWGHNSHSSEGYCDIFVTVCPALNGEGSDSDMPTPYWEALMVAVKHHVRPNATE… |
| D3SGG8 | 11-112 | None |
| A0A2E7E5F9 | 155-255 | None |
| A0A2W6SZK5 | 165-262 | None |
| A0A7Y0WK22 | 11-106 | None |
| A0A3N9S196 | 94-188 | None |
| A0A5M3Q3J5 | 10-113 | None |
| A0A0B5FJI4 | 1-92 | None |
| A0A1M5TKM8 | 117-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.