DPCstruct | MC12907
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 102 ± 13 aa |
| Standard deviation of domain lengths | 13.13 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A546Z4S1 | 2-95 | SAEVWTKKDFDELLRMWIDGKTTVQIAEELGRTPRAVSTKGSRLGLFSLTQQELAEPGVAVRTCLNPVNPHPFVSAGKWNRTCITCK… |
| A0A1G3HIM5 | 1-105 | MTRRLWTPEEDARLIALRGAGKTQKWIAADLGRPESSIPSRLGKLAIRRRQPALLGNPAPACASGQRAHVKNGGLGERKWRKCLCCG… |
| A0A7Z1UPN7 | 28-131 | None |
| A0A350YK87 | 28-169 | None |
| A0A7V1BE46 | 14-119 | None |
| A0A6L7LGI0 | 1-110 | None |
| A0A2W5KB80 | 50-141 | None |
| A0A1G8GJS1 | 161-263 | None |
| A0A0B4Y5G1 | 1-121 | None |
| A0A2A6PPE4 | 1-86 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.