DPCstruct | MC12906
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 161 ± 51 aa |
| Standard deviation of domain lengths | 50.62 |
| Length coefficient of variation | 0.31 |
| Mean AlphaFold2 pLDDT confidence score | 84.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.62 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G1H0F0 | 36-179 | KGKTKEGLDIELLTKTIKEKLGDKLLGHFYTEKILSQKNLKTVKLFHPTKDIHIKNELFGWRLSSGKDHIDCQSEAEAEYLKIWLES… |
| A0A353CDV5 | 4-137 | AAEFRNSLGDSWIPTIYEDRIRKLRTRSFELDIPERENDPTIEMTLLGVELRVGRKRIACPDIETARYLAIFAILGCAKVAVPYDIT… |
| A0A3N5PVI4 | 57-206 | None |
| A0A2H9PH03 | 2-102 | None |
| A0A2R7Y4E7 | 144-287 | None |
| F2NH04 | 175-314 | None |
| F2NH03 | 116-272 | None |
| A0A2R6ALC3 | 443-621 | None |
| A0A2E0W6Q6 | 5-156 | None |
| A0A7Y4UBH7 | 21-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.