DPCstruct | MC12905
Metacluster Properties and Pfam Annotations
| Number of structural domains | 447 |
|---|---|
| Mean domain length (aa) | 307 ± 79 aa |
| Standard deviation of domain lengths | 79.43 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 86.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 15.03 |
| Pfam Score | 78.62 |
| Assigned Pfam label(s) | CL0126- PF01984- CL0209- CL0020- CL0512 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5PM48 | 5-330 | AWLAAGVRQTPDAVIRALDMGGDEIIFPVNRVAASAGGWGDYPRAIVWAFLERGMQPTGLEAVLASDVPVGAGMSSSAAVEMAFAYA… |
| A0A090TH18 | 4-251 | SVVVYAPASIGNVSVGFDVLGAAVSPVDGTLLGDCVEVRLGDKPFDLATKGSFVDKLPSDPKENIVYDCWKVYARELDKKGVTLKPV… |
| A0A7R9KFB9 | 22-322 | None |
| A0A7J6L8Q7 | 916-1191 | None |
| A0A819XFH6 | 23-454 | None |
| A0A0A0DXN0 | 3-218 | None |
| I1CMZ8 | 42-325 | None |
| I1CD02 | 11-323 | None |
| A0A226F6X6 | 532-891 | None |
| A0A0D9VNM4 | 911-1250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.