DPCstruct | MC1290
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 163 ± 15 aa |
| Standard deviation of domain lengths | 14.53 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.77 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A810ZTF9 | 1-181 | MTTLAAFPDGLKHTALNGYYRNLLTRVEQGTTSQRSVRMALTSAGEALLACGPDRDDLPSTQSMLALLRKSPGSTASLTGFVLYLNK… |
| A0A0D5M9A5 | 1-153 | METRIEAGTTSHTSARLALSAAAALLLNTDREGQRLPNQGDVDSYLSTVPGQAALVTGFTNFLNRQHATTLTPRVDEKRARKRRKEK… |
| F8XP66 | 142-315 | None |
| A0A451G4N6 | 120-269 | None |
| A0A5P9W180 | 217-386 | None |
| A0A1H9H1N3 | 2-142 | None |
| N9S8Z5 | 317-498 | None |
| A0A2M8H952 | 71-224 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.