DPCstruct | MC129
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 313 ± 6 aa |
| Standard deviation of domain lengths | 5.61 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 87.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 41.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0163 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D8Q785 | 12-314 | ARPVVTDLTICIFPTTIPPSTCEVDSRMWHRLEKELYLYTSQQSAWLYVALADEEELSAEDLLVMDIRVGESPPNPSSGHSWESRPG… |
| A0A063BUA9 | 368-679 | PGLVITDITLVTCSTLNPFSSCELDSDVWHRVDKELYLGRAWTTTAYLYISRKHEKELTSEDMVVMDVSVGRLNPAEANQGKAVKND… |
| A0A1B9HCZ8 | 194-513 | None |
| A0A0G4KX66 | 46-356 | None |
| A0A4S2MIK8 | 198-516 | None |
| A0A5N6G1N2 | 297-614 | None |
| A0A2S6CMW4 | 7-318 | None |
| A0A2S7NM62 | 472-778 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.