DPCstruct | MC12898
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 134 ± 13 aa |
| Standard deviation of domain lengths | 13.21 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 24.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A257L3Y6 | 32-183 | VIGSLLLLVSCDENNTHSSDNRNEQKSDSGIFLSPSQFTPITFLQSVTPKTKVDSSLNTFVIYTHFPADWVKASYIDTLLTLLNSQQ… |
| A0A7J5A731 | 47-167 | KKVYMSDTNVKDFVNILKANTTDKDTLDFIITVGQTNSSWISNNDLDFLISKINSKEKANCINRRISSIIPNSKNITLGHQIISIIE… |
| A0A4Q2ZTM0 | 3-139 | None |
| A0A2D2DFV6 | 9-142 | None |
| A0A238U663 | 20-160 | None |
| A0A7W7N7G8 | 22-152 | None |
| A0A1Z3N998 | 1-133 | None |
| A0A0Q0ZQQ0 | 61-176 | None |
| A0A1F5UCJ9 | 334-459 | None |
| A0A4U8YYZ8 | 6-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.