DPCstruct | MC12897
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 103 ± 7 aa |
| Standard deviation of domain lengths | 7.02 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 22.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19147 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W7Q8X1 | 80-178 | LMRDVTTIRLAVTQRDLDSTVPLLRAGGFQVRSAPGGITARSGKTTIRFDVVPVHQVGLRQVDFSLNRSVGYRHTERIGRSTLVVGP… |
| A0A257L2L7 | 1-113 | MTYKQFNGILSNGRKYPRQFSMVTYIKLYADKKLMDRLQDYAKLNNCRKVKNTFTNGETTVEYIEVQNLPQFPIQEIGISLMNDQIY… |
| A0A7Y4SXA1 | 344-452 | None |
| A0A4D4MMH7 | 1-99 | None |
| A0A3A8T7E5 | 532-628 | None |
| A0A7Y4VWU0 | 200-292 | None |
| A0A660ZAV5 | 171-267 | None |
| A0A7H8I0Z9 | 116-218 | None |
| A0A432MDJ3 | 106-211 | None |
| A0A0G0GQM4 | 24-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.