DPCstruct | MC12896
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 107 ± 13 aa |
| Standard deviation of domain lengths | 12.84 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 42.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A831XR34 | 1-96 | HDVECIYHGVNCGNGGGPIVYHLADGVERFAVENVADPGASSLAQSDIWIMLDCLDAYGEIFNHLPGGCNVLYLDGHVEFVKYKAKP… |
| A0A7V3DGX3 | 36-149 | LLDTHDNPAGAVAVTESEWPVPEGTGNANGNKIFRLREGIERFLVTDINNPAGTAQAQSALAIMWDVISGDEASHFNHVPGGCNVLY… |
| A0A7C1CP29 | 219-339 | None |
| A0A7C1GKR9 | 3-106 | None |
| A0A7C2W8Q0 | 46-163 | None |
| A0A7C2WBD3 | 161-254 | None |
| A0A7C2WIX2 | 65-174 | None |
| A0A847G7U2 | 61-175 | None |
| A0A7C3WRT2 | 79-201 | None |
| E9I435 | 21-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.