DPCstruct | MC12895
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 98 ± 10 aa |
| Standard deviation of domain lengths | 9.89 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 75.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3KUL3 | 1-100 | MHGFVCDACGETLLLTSDVRYVVRIEGFAAYDPLELTKRDLERDFEAEMRQILKELESLSEGEAADQVHRAFAYDLCPDCWAAYLRD… |
| A0A831UPG8 | 1-102 | MITYRCDGCGKELEQHALRYTVEIEVKAAYDKMQVGLLDLVRDHRAEMLRLIERLKHRDPKEIEESVYKRIHLDLCPNCQRAFNKNP… |
| A0A660V8X5 | 1-88 | None |
| A0A349VHF2 | 53-153 | None |
| A0A832LRQ4 | 23-112 | None |
| A0A7C3SUI5 | 1-115 | None |
| A0A5C6CSN7 | 1-97 | None |
| A0A5C6F3C5 | 1-118 | None |
| A0A6P2D9R3 | 63-156 | None |
| A0A849ZLV5 | 6-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.