DPCstruct | MC12893
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 217 ± 31 aa |
| Standard deviation of domain lengths | 31.04 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 85.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 25.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12077 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A655AV75 | 2-202 | IAVVAVVIMGNLLPEKISFLPAMRYYAGNWATSIWCFRGDAEATMETSVVKSSALVVNQLAKLYDGATAEIMTDKVAAFRAMHTHGR… |
| A0A7Z9HXU8 | 6-229 | EWNMLSAYCGIFLFGYHPEVGLFEVGSVPMVIYLLIGCLIVPLVGNFVPRAVSFLLAMRYYAGNWAWNAWLFHNGSYEKLDKLTRAS… |
| A0A7S1F8C7 | 327-563 | None |
| A0A7I7LL98 | 3-137 | None |
| A0A812J5Q0 | 339-588 | None |
| A0A812G9L2 | 478-691 | None |
| A0A812I641 | 205-429 | None |
| A0A534PEG2 | 1-169 | None |
| A0A7S0LG16 | 403-662 | None |
| A0A813FVL5 | 220-450 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.