DPCstruct | MC12892
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 110 ± 15 aa |
| Standard deviation of domain lengths | 14.87 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 91.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Q3UZP1 | 52-163 | TARQTLATVRRLISASRRPPIIVVQGDHGPKSGLSQNSLNDTDLNECVPNLNAYYVPPTIRAGLRPGITPVNSFRIILHGIFGLDLP… |
| A0A7Z9HW22 | 5-99 | IRKSDPGAVIVLQGDHGPGSQYVGNSLAKTNMHERSGILNAYLFPDADYSSLYPAITPANTFRVISNRFFKTEFELVEDTTYSSSTA… |
| R6PER4 | 36-142 | None |
| A0A537J2U7 | 39-127 | None |
| A0A523FEN2 | 11-138 | None |
| A0A1V5VPD4 | 10-97 | None |
| A0A0S8KLF1 | 1-131 | None |
| A0A523FV35 | 95-219 | None |
| A0A1V5PG16 | 272-388 | None |
| A0A2V9JPP4 | 176-282 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.