DPCstruct | MC12891
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 184 ± 23 aa |
| Standard deviation of domain lengths | 23.26 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 20.21 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L7UG66 | 292-441 | VFVAVFVLLFLLINLVFDGPVRACTETLDRKPLTTGLTGFLTILLIAPVSFILTVSVVGLALVPFLWLAFLIAGLIGDVAAARWIGS… |
| A0A7Y5F9Z7 | 6-159 | ALGFMAALLGLLAVKAGCVAMSVWLDKSAPAFTARALNVYQTRGKRSFVLGVVNGLLLFFLFTALTNAQLKPLGVLGIVILLATAAA… |
| A5UTB3 | 97-275 | None |
| A0A6B0HLK0 | 3-180 | None |
| A0A6N6L220 | 3-163 | None |
| A0A7W1H8E7 | 31-258 | None |
| A0A3B9YJS7 | 155-310 | None |
| A0A1R4JXW7 | 338-525 | None |
| A0A848XQE4 | 36-236 | None |
| A0A661U4S6 | 144-333 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.