DPCstruct | MC1289
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 81 ± 13 aa |
| Standard deviation of domain lengths | 12.99 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 44.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V0YJL1 | 1-87 | MTMVHERTRSVVQTEAFLRDIVRDVTLPEKMRLRAEGLLRHYPAPSYIWLAGKLEEHRRAELSRLDEKFGPLPPVLGTWLAIEPMFF |
| A0A0D5M810 | 26-95 | MTMPSERTRSVIQTREFLIELSRNTDFPATIRREAKQLLRHYPSQIEMLDAGQMEEHLTDGTIFQPIFSP |
| A0A0R0CVN6 | 1-76 | None |
| A0A6C0TS06 | 1-95 | None |
| A0A6C0TP28 | 1-63 | None |
| A0A3M5A6H5 | 19-98 | None |
| A0A0N8Q9E9 | 38-119 | None |
| A0A4S2B8F7 | 1-71 | None |
| A0A125R0A3 | 1-73 | None |
| A0A1H1QEC2 | 43-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.