DPCstruct | MC12887
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 166 ± 32 aa |
| Standard deviation of domain lengths | 31.68 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 71.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 27.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10306 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R1PZJ9 | 123-280 | EKESKKDTGNTDNNSNPQDSKPKPKKNTFEYYKSQFKSKPGSHLVSFLLLHELTAILPIFLIYYYLKLTDYQFDFLFNFSSSQLSEY… |
| A0A507DKF8 | 2-107 | YVYVVAFAILHEVTAVLPLPIIYYALQHSDIHIPIPDYLVVEANKKATKLMKLFGLGALEQDSRALLDMATSYAVVKVALPARIGLS… |
| G8BEE1 | 64-226 | None |
| A0A4U0XUP3 | 815-974 | None |
| A0A1S8VGM1 | 9-181 | None |
| A0A2T6ZXC7 | 29-176 | None |
| A0A6G1I452 | 6-196 | None |
| A0A4T0W4V2 | 357-573 | None |
| A0A1E3NHI6 | 6-241 | None |
| A0A261Y8D5 | 793-923 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.