DPCstruct | MC12886
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 230 ± 43 aa |
| Standard deviation of domain lengths | 43.24 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 68.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.71 |
| Mean length-normalized TM-Score | 0.24 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.99 |
| Pfam Score | 96.27 |
| Assigned Pfam label(s) | CL0361- CL0449 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4V1IY08 | 6-224 | QRNKGYALLQKMGWKAGQGLGVKEEGVKEPIQVNEATDTRGLGKKTQEDQYIREVGRKRKTTDGERIAQETSEEREARESRVRKRQA… |
| A0A1R1PU31 | 3-210 | LAEVKVKQRIGVDPRNLNWGNDKDKFGYKLMQKMGWKEGKGLGANESGMTDSLKVRLKLNNHGIGANKKSIENWMESSGDFEAVLAR… |
| A0A6J1PDJ7 | 1-214 | None |
| A0A6V7TPF0 | 1-147 | None |
| A0A2P6NTG4 | 36-221 | None |
| A0A6U3RUZ0 | 19-223 | None |
| R7U3A2 | 2-237 | None |
| A0A835XM77 | 1-286 | None |
| B4DVU2 | 1-184 | None |
| E2C7C0 | 1-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.