DPCstruct | MC12883
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 122 ± 13 aa |
| Standard deviation of domain lengths | 12.72 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 44.73 |
| Pfam Score | 94.50 |
| Assigned Pfam label(s) | PF00187- CL0187 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L9V3P3 | 141-257 | GGSLPDLTPQPNDNGTCYSYTVQDGDYCALLAEEYYITTDEIEEYNAQTWGWMGCSNLQLDAVICLSSGEPPMPAVLPNAVCGPQVE… |
| A0A1R1PDV8 | 96-230 | DEYDQVEVHEGEEPLMRRAYFDAHEIGSSPGGCTLYRVELGDTCYLISQDFGITIDDLEKFNKSNSGWGGCGSLRAGSLICLDAGTA… |
| Q9C127 | 104-210 | None |
| A0A2S4LAS4 | 359-474 | None |
| A0A2S4L5L7 | 363-478 | None |
| A0A421JHV1 | 117-239 | None |
| A0A2V1DDP9 | 13-128 | None |
| A0A4Z0YWL1 | 230-341 | None |
| A0A162LXD7 | 399-514 | None |
| A0A2T4C3W9 | 119-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.