DPCstruct | MC12880
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 148 ± 14 aa |
| Standard deviation of domain lengths | 14.00 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 38.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812QER2 | 180-298 | YASLEVNTNTGAVTMMNASGTPIDIIGYSVLSDSGGLNPAGWTSMTEQSVAGWEETAPSPQSLSELNSQGSLALTGTAIQLGNVYVS… |
| A0A3E0MZ99 | 56-233 | MKQSLATLMAIAAVLVFTSVASAGLTPSEAGDPAIPDLIYDSATGEVTLDVDASPGIIGYSLQNATNSFIPGNFTPILVGVSTALTS… |
| A0A3E0NE48 | 301-446 | None |
| A0A3E0NCI5 | 962-1098 | None |
| A0A3E0NBM8 | 434-582 | None |
| A0A518KD84 | 178-318 | None |
| A0A5C5YWV5 | 90-237 | None |
| A0A812JTZ3 | 179-311 | None |
| A0A3E0N3J5 | 7-177 | None |
| A0A3E0N5Z2 | 533-680 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.